General Information

  • ID:  hor002182
  • Uniprot ID:  P67971
  • Protein name:  Insulin A chain
  • Gene name:  INS
  • Organism:  Saimiri sciureus (Common squirrel monkey)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Saimiri (genus), Saimiriinae (subfamily), Cebidae (family), Platyrrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GVVDQCCTSICSLYQLQNYCN
  • Length:  21
  • Propeptide:  FVNQHLCGPHLVEALYLVCGERGFFYAPKTGVVDQCCTSICSLYQLQNYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-11
  • Structure ID:  AF-P67971-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002182_AF2.pdbhor002182_ESM.pdb

Physical Information

Mass: 271161 Formula: C97H152N26O34S4
Absent amino acids: AEFHKMPRW Common amino acids: C
pI: 3.75 Basic residues: 0
Polar residues: 12 Hydrophobic residues: 5
Hydrophobicity: 20 Boman Index: -1937
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 83.33
Instability Index: 2982.38 Extinction Coefficient cystines: 3230
Absorbance 280nm: 161.5

Literature

  • PubMed ID:  2263627
  • Title:  Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.